gamma-glutamyl bond is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Updated 2026-03-04. Numbers and descriptions here follow the published literature rather than marketing material.
Measuring glutathione in biological samples requires attention to oxidation, because GSH can convert to GSSG after sample collection. Blood and plasma samples are often treated with acid or alkylating agents to preserve the reduced form. Without stabilization, apparent GSH concentrations can fall while GSSG rises. Differences in sample type, handling delay, and deproteinization method can produce results that are not comparable across studies. Reporting preanalytical details is therefore important for interpreting findings.
Common analytical approaches include enzymatic recycling assays, high-performance liquid chromatography, and mass spectrometry. Enzymatic recycling measures total glutathione after converting GSSG back to GSH, while separation methods can quantify GSH and GSSG separately. Derivatization may be used to improve detection or stability during analysis. LC-MS/MS offers high specificity and can distinguish glutathione from related thiols and adducts. Each method has different sensitivity, throughput, and susceptibility to interference, so method selection depends on the study question and sample matrix.
Glutathione is a small sulfur-containing peptide built from glutamic acid, cysteine, and glycine. Its distinctive feature is a gamma-glutamyl bond between glutamate's side-chain carboxyl group and cysteine's amino group. This linkage resists ordinary peptidases and helps the molecule remain stable inside cells. The reduced thiol form, often abbreviated GSH, is the dominant intracellular species. The oxidized disulfide dimer, GSSG, forms when two reduced molecules link through their cysteine sulfur atoms. The balance between these forms is a common redox indicator.
In living systems, glutathione occurs in millimolar concentrations in many cell types, while extracellular levels are generally much lower. The liver holds a substantial share of the body's total pool, and the molecule participates in reduction, detoxification, and amino acid transport. It also serves as a cofactor for enzymes such as glutathione peroxidase and glutathione S-transferase. Because the cysteine residue supplies a reactive thiol, glutathione can donate electrons and become oxidized. Cells regenerate reduced glutathione through glutathione reductase using NADPH.
| Property | Value | Notes |
|---|---|---|
| Typical analytical method | LC-MS/MS, HPLC, or enzymatic recycling | Choice depends on whether total, reduced, or oxidized glutathione is measured. |
| Sample stabilization | Acidification or thiol alkylation | Helps limit conversion of GSH to GSSG after collection. |
| Solution stability | Limited at room temperature | Oxidation and pH-dependent degradation can occur. |
| Storage of solid | -20 °C, desiccated, protected from light | Common for research reagents; follow supplier instructions. |
| Common interference | Other thiols and metal ions | Can affect separation or enzymatic detection. |
Several techniques are used for quantification. Enzymatic recycling assays rely on glutathione reductase and a colorimetric or fluorescent readout, offering sensitivity for total glutathione. High-performance liquid chromatography can separate GSH from GSSG and other thiols, often with UV, fluorescence, or electrochemical detection. Mass spectrometry provides structural confirmation and can quantify low-abundance species when paired with separation. Each approach has trade-offs in specificity, throughput, and equipment requirements, so method selection depends on the research question and available instrumentation.
Stability depends on pH, temperature, oxygen exposure, and trace metals. Aqueous solutions of reduced glutathione are susceptible to oxidation, especially when neutral or alkaline and exposed to air. Transition metal ions can catalyze thiol oxidation, so chelators and inert atmospheres are sometimes used in research settings. Standards are typically stored cold and desiccated, with limited freeze-thaw cycles. Questions remain about how closely in vitro stability data reflect the behavior of glutathione within intact cells and tissues.
Quality control for glutathione focuses on identity, purity, and oxidation state. Certificates of analysis may report assay value, water content, and the presence of GSSG or other impurities. Chromatographic purity is often expressed as a percentage of peak area. Reference standards help laboratories compare results across instruments and batches. Because glutathione is a small, polar molecule, separation from cysteine, gamma-glutamylcysteine, and related thiols can be challenging. Verification often combines more than one analytical technique.
Measuring glutathione requires attention to sample preparation because the molecule oxidizes readily. Blood, tissue, and cell samples are often treated with acid to precipitate proteins and stabilize the thiol. Without such steps, GSH can convert to GSSG or form mixed disulfides during storage. Analytical methods include spectrophotometric assays, high-performance liquid chromatography, and mass spectrometry. Each approach has different sensitivity, specificity, and susceptibility to interference from related compounds in complex matrices.
For solid glutathione, storage conditions affect shelf life. The reduced form is typically kept cool, dry, and protected from air and light. Moisture can promote oxidation, while elevated temperatures accelerate degradation. Suppliers often specify storage at or below freezing, sometimes under inert gas. Solutions are less stable than powders and may require preparation shortly before use. Buffers and chelating agents can slow oxidation, but they do not eliminate it. Published stability data vary with matrix, pH, and container.
An ant's head contains many sensory organs. Like most insects, ants have compound eyes made from numerous tiny lenses attached together. Ant eyes are good for acute movement detection, but do not offer a high resolution image. They also have three small ocelli (simple eyes) on the top of the head that detect light levels and polarization. Compared to vertebrates, ants tend to have blurrier eyesight, particularly in smaller species, and a few subterranean taxa are completely blind. However, some ants, such as Australia's bulldog ant, have excellent vision and are capable of discriminating the distance and size of objects moving nearly a meter away. Based on experiments conducted to test their ability to differentiate between selected wavelengths of light, some ant species such as Camponotus blandus, Solenopsis invicta, and Formica cunicularia are thought to possess a degree of colour vision. Two antennae ("feelers") are attached to the head; these organs detect chemicals, air currents, and vibrations; they also are used to transmit and receive signals through touch. The head has two strong jaws, the mandibles, used to carry food, manipulate objects, construct nests, and for defence. In some species, a small pocket (infrabuccal chamber) inside the mouth stores food, so it may be passed to other ants or their larvae.
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs (such as Teduglutide) may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. GLP-2 has an antidepressant effect in a mouse model of depression when delivered via intracerebroventricular injection. However, a GLP-2 derivative (PAS-CPP-GLP-2) was shown to be efficiently delivered to the brain intranasally, with similar efficacy.
Eosinophilic cutaneous conditions encompass a wide variety of diseases that are characterized histologically by the presence of eosinophils in the inflammatory infiltrate, or evidence of eosinophil degranulation.
Sources: en.wikipedia.org
Testing for the presence of residual solvents in Active Pharmaceutical Ingredients (APIs) is critical for patient safety and commonly follows United States Pharmacopeia (USP) Method <467> guidelines, or more broadly, International Council for Harmonisation (ICH) Guideline Q3C(R6). The gas chromatography (GC) runtime suggested by USP Method 467 is approximately 60 min. A generic method for residual solvent analysis by GC-MS describes conditions that include a runtime of approximately 30 minutes. A GC-VUV and static headspace method was developed using a chromatographic compression strategy that resulted in a GC runtime of 8 minutes. The GC-VUV method uses a flow rate of 4 mL/min and an oven ramp of 35 °C (held for 1 min), followed by an increase to 245 °C at a rate of 30 °C/min. Figure 5 compares the results when the general conditions of the GC-MS method were followed against the GC-VUV method run with Class 2 residual solvents. Tetralin eluted at approximately 35 minutes using the GC-MS method conditions, whereas the analyte had a retention time of less than 7 minutes when the GC-VUV method was applied. The co-elution of m- and p-xylene occurred in both GC-MS and GC-VUV method runs. VUV software matched the analyte absorbance of both isomers with VUV library spectra (Figure 2) to deconvolve the overlapping signals as displayed in Figure 6. Goodness of fit information ensures that the correct compound assignment takes place during the post-run data analysis.
== Preparations == The Gemini 4 spacecraft completed major manufacturing activity, module tests, and equipment installation at McDonnell at the end of January 1965. The spacecraft was mated to the Titan II launch vehicle at Cape Canaveral Launch Complex 19 on April 23, 1965. Final system tests were performed over several additional weeks. NASA leadership approved the Gemini 4 EVA plan on May 25, 1965; the public was informed on the same day
Mirela Delibegovic, is a Bosnian-British pharmacologist/biochemist who is Dean for Industrial Engagement in Research & Knowledge Transfer and Director of Aberdeen Cardiovascular and Diabetes Centre. She is also Regius Professor of Physiology at the University of Aberdeen. During the COVID-19 pandemic, Delibegovic used artificial intelligence to develop technologies that would allow mass-screening for coronavirus disease 2019.
Although Mr Galloway, Mr Halford and Mr Al-Mukhtar have confirmed that they were unaware of the source of Mr Zureikat's donations, the Commission has concluded that the charity trustees should have made further enquiries when accepting such large single and cumulative donations to satisfy themselves as to their origin and legitimacy. The Commission's conclusion is that the charity trustees did not properly discharge their duty of care as trustees to the Appeal in respect of these donations ... The Commission is also concerned, having considered the totality of the evidence before it, that Mr Galloway may also have known of the connection between the Appeal and the Programme. Galloway, in response, stated: "I've always disputed the Commission's retrospective view that a campaign to win a change in national and international policy – a political campaign – was, in fact, a charity".
Sources: en.wikipedia.org
As an expansion pack for Half-Life, Opposing Force is a first-person shooter. The overall gameplay of Opposing Force does not significantly differ from that of Half-Life. Players navigate through levels, fight hostile non-player characters and solve a variety of puzzles to advance. The game continues Half-Life's methods of an unbroken narrative. The player sees everything through the first person perspective of the protagonist and remains in control of the player character for almost all of the game. Story events are conveyed through the use of scripted sequences rather than cut scenes. Progress through the world is continuous; although the game is divided up into chapters, the only significant pauses are when the game needs to load the next part of an environment. Opposing Force also features an extended multiplayer, incorporating the various new environments and weapons into the original deathmatch mode used in Half-Life. After release, a new capture the flag mode with additional levels, items and powerups, was created by Gearbox. For the most part the player battles through the single-player game alone, but is occasionally assisted by friendly non-player characters. Security guards and scientists will occasionally help the player in reaching new areas and convey relevant plot information. However, Opposing Force also features fellow U.S. Marines who will assist the player in combat to a far greater degree than security guards.
Water is the main source of hydrogen for all living things, so the isotopic composition of environmental water is a first-order control on that of the biosphere. The water (hydrological) cycle moves water around Earth's surface, significantly fractionating the hydrogen isotopes in water. As the atmosphere's main moisture source, the ocean has a fairly uniform HIC across the globe around 0‰ (VSMOW). Variations of δD larger than 10‰ in the ocean are generally confined to surface water due to evaporation, sea ice formation, and addition of meteoric water by precipitation, rivers or icebergs. In the water cycle, the two main processes that fractionate hydrogen isotopes from seawater are evaporation and condensation. Oxygen isotopic composition (18O/16O) of water is also an important tracer in the water cycle, and cannot be separated from hydrogen isotopes when we talk about isotope fractionation processes associated with water. When water evaporates from the ocean to the air, both equilibrium and kinetic isotope effects occur to determine the hydrogen and oxygen isotopic composition of the resulting water vapor. At the water-air interface, a stagnant boundary layer is saturated with water vapor (100% relative humidity), and the isotopic composition of water vapor in the boundary layer reflects an equilibrium fractionation with liquid water. The liquid-vapor equilibrium fractionations for hydrogen and oxygen isotopes are temperature-dependent:
=== Cancer === As of 2023, regulatory agencies, including the FDA and EFSA, and the US National Cancer Institute, have concluded that consuming aspartame is safe in amounts within acceptable daily intake levels and does not cause cancer. These conclusions are based on various sources of evidence, such as reviews and epidemiological studies finding no association between aspartame and cancer. In July 2023, scientists for the International Agency for Research on Cancer (IARC) concluded that there was "limited evidence" for aspartame causing cancer in humans, classifying the sweetener as Group 2B (possibly carcinogenic). The lead investigator of the IARC report stated that the classification "shouldn't really be taken as a direct statement that indicates that there is a known cancer hazard from consuming aspartame. This is really more of a call to the research community to try to better clarify and understand the carcinogenic hazard that may or may not be posed by aspartame consumption." The Joint FAO/WHO Expert Committee on Food Additives (JECFA) added that the limited cancer assessment indicated no reason to change the recommended acceptable daily intake level of 40 mg per kg of body weight per day, reaffirming the safety of consuming aspartame within this limit.
coli for instance, a prominent example is FKBP-type peptidyl prolyl isomerase, which appears around 25 kDa on SDS-PAGE. These impurities can be eliminated using additional purification steps or by expressing the recombinant protein in a deficient strain of cells. Alternatively, cobalt charged IMAC resins which have less affinity for endogenous proteins can be used.
Alex Browne (born 9 August 1992) is a former professional Australian rules footballer who played for the Essendon Football Club in the Australian Football League (AFL). Browne played for the Oakleigh Chargers in the TAC Cup. He was drafted by Essendon with pick 48 in the 2010 national draft and made his debut against Melbourne at the Melbourne Cricket Ground in round 11 of the 2011 AFL season. He was delisted in October 2015. His father, Murray Browne, played for Collingwood and Fitzroy in the 1980s and his mother was a cheerleader for Carlton. Browne, along with 33 other Essendon players, was found guilty of using a banned performance-enhancing substance, thymosin beta-4, as part of Essendon's sports supplements program during the 2012 season. He and his teammates were initially found not guilty in March 2015 by the AFL Anti-Doping Tribunal, but a guilty verdict was returned in January 2016 after an appeal by the World Anti-Doping Agency. He was suspended for two years which, with backdating, ended in November 2016; as a result, he served approximately fourteen months of his suspension. Browne had signed for the Northern Blues in the Victorian Football League for the 2016 season before his suspension ended his 2016 season.
Sources: en.wikipedia.org
Preanalytical factors such as sample type, time to processing, and stabilization method can change GSH and GSSG amounts. Analytical method and calibration also contribute to variation. Comparing absolute values across studies requires caution.
These assays typically measure total glutathione after oxidizing or reducing steps convert GSSG to GSH. A colorimetric or fluorometric signal is proportional to the recycling reaction. They generally do not report GSH and GSSG separately unless additional steps are used.
Solutions are often prepared fresh and kept cold, with protection from light and oxygen exposure. Chelating agents may reduce metal-catalyzed oxidation. Storage recommendations vary by buffer, pH, and concentration, so protocol-specific guidance should be followed.
It is a tripeptide rather than a full protein. Proteins generally contain many amino acids joined by alpha-peptide bonds, while glutathione has three residues and an unusual gamma-glutamyl linkage. That structure affects how enzymes recognize and break it down.